Peptide Name Index
Match any peptide nickname, brand name or development code to the compound behind it: its sequence, molecular formula and weight, CAS number, PubChem record, FDA UNII and primary target.
56 peptides
| Peptide | Also known as | Primary target or action | Sequence (one-letter) | Formula · weight | Identifiers |
|---|---|---|---|---|---|
| AbaloparatideFDA-approved peptide medicineApproved Medicine | TymlosBIM-44058BA058 | PTH1 receptor agonist (PTHrP analogue) | AVSEHQLLHDKGKSIQDLRRRELLEKLL-Aib-KLHTA-NH2 | C174H300N56O493961.0 g/mol | CAS 247062-33-5PubChem CID 76943386UNII AVK0I6HY2UIdentifiers are for the free base; the medicine is formulated as abaloparatide acetate (UNII C4LQA2B9H4). |
| AfamelanotideFDA-approved alpha-MSH analogue (MC1 receptor agonist) implantApproved Medicine | ScenesseCUV1647[Nle4, D-Phe7]-alpha-MSHNDP-MSH | MC1 receptor agonist (α-MSH analogue) | Ac-SYS-Nle-EH-dF-RWGKPV-NH2 | C78H111N21O191646.8 g/mol | CAS 75921-69-6PubChem CID 16197727UNII QW68W3J66UIdentifiers are for the free base. The approved implant contains afamelanotide acetate (UNII 1XCC161YKC). |
| AOD-9604Synthetic peptide fragmentUnapproved | hGH Fragment 177-191 DerivativeAdvanced Obesity Drug 9604Lipolytic fragmentTyr-hGH177-191 | Growth hormone fragment; no receptor identified; lipolytic effects in animals | YLRIVQCRSVEGSCGF | C78H123N23O23S21815.1 g/mol | CAS 221231-10-3PubChem CID 71300630UNII 7UP768IP4M |
| ArgirelineCosmetic peptide ingredient (not a drug)Unapproved | Acetyl Hexapeptide-3 (Acetyl Hexapeptide-8)Acetyl Hexapeptide-3Acetyl Hexapeptide-8Acetyl Hexapeptide-8 AmideAc-EEMQRR-NH2AH-8 | SNARE-complex interference (proposed; cosmetic) | Ac-EEMQRR-NH2 | not assigned | CAS 616204-22-9PubChem CID 71587772UNII L4EL31FWILMolecular formula and weight are not shown because the PubChem record’s computed formula does not match the stated sequence; FDA GSRS gives none. |
| BPC-157Research peptideUnapproved | Body Protection Compound 157PL 14736Bepecin | No identified receptor; proposed effects on blood-vessel growth and tendon cells (animal and cell studies) | GEPPPGKPADDAGLV | C62H98N16O221419.5 g/mol (free base) | CAS 137525-51-0PubChem CID 9941957UNII 8ED8NXK95PIdentifiers are for the free base; BPC-157 acetate carries UNII PAR2FC72XP. |
| BremelanotideFDA-approved peptide medicineApproved Medicine | VyleesiPT-141Cyclic Melanocortin Agonist | Melanocortin receptor agonist (MC4R-mediated) | Ac-Nle-c[DH-D-Phe-RWK] | C50H68N14O101025.2 g/mol | CAS 189691-06-3PubChem CID 9941379UNII 6Y24O4F92SIdentifiers are for the free base. The approved medicine contains bremelanotide acetate (UNII PV2WI7495P). |
| CagrilintideInvestigational peptide medicineInvestigational | CagriSemacagrilintide-semaglutidelong-acting amylin analogue | Amylin receptor agonist, long-acting | C20 diacid-γGlu-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (disulfide between the two Cys) | C194H312N54O59S24409 g/mol (PubChem computed) | CAS 1415456-99-3PubChem CID 171397054UNII AO43BIF1U8Identifiers are for the free base; cagrilintide hydrochloride carries UNII 3SBY6D7WH7. |
| CJC-1295Synthetic GHRH analogueUnapproved | Modified GRF (1-29) / Tetrasubstituted GHRHDAC:GRFModified Growth Hormone Releasing FactorTetrasubstituted GHRH(1-29) | GHRH receptor agonist, long-acting (albumin-binding) | Y-D-Ala-EDAIFTQSYRKVLAQLSARKLLQDI-LSR-NH2 | C165H269N47O463647.2 g/mol (PubChem computed) | CAS 446262-90-4PubChem CID 91971820UNII 62RC32V9N7Identifiers refer to CJC-1295 with the DAC albumin-binding group (FDA GSRS and PubChem). Products sold as "CJC-1295 without DAC" are modified GRF(1-29): CAS 863288-34-0, C152H252N44O42, 3367.9 g/mol. |
| DihexaAngiotensin IV-derived research compound (unapproved)Unapproved | N-hexanoic-Tyr-Ile-(6)-aminohexanoic amidePNB-0408ATH-1001Hexanoyl-Tyr-Ile-Ahx-NH2Dihexa acetate | HGF/c-Met pathway (proposed; key paper retracted) | not assigned | C27H44N4O5504.7 g/mol | CAS 1401708-83-5PubChem CID 129010512UNII 9WYX65A5C2 |
| DSIPResearch neuropeptide (unapproved)Unapproved | Delta Sleep-Inducing Peptide (Emideltide)Delta Sleep-Inducing PeptideEmideltideTrp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-GluWAGGDASGE | No identified receptor | WAGGDASGE | C35H48N10O15848.8 g/mol | CAS 62568-57-4PubChem CID 68816UNII YN28Z5YZ73 |
| DulaglutideFDA-approved GLP-1 receptor agonist (Fc-fusion protein)Approved Medicine | TrulicityLY2189265 | GLP-1 receptor agonist (Fc-fusion protein) | not assigned | not assignedapproximately 63 kDa (U.S. label) | CAS 923950-08-7PubChem not assignedUNII WTT295HSY5Dulaglutide is an Fc-fusion protein, so it has no PubChem compound record; identifiers are from FDA GSRS. |
| ElamipretideFDA-approved peptide medicineApproved Medicine | ForzinitySS-31MTP-131BendaviaSzeto-Schiller peptide | Cardiolipin-binding mitochondrial peptide | D-Arg-Dmt-Lys-Phe-NH2 | C32H49N9O5639.8 g/mol (free base) | CAS 736992-21-5PubChem CID 11764719UNII 87GWG91S09 |
| EpitalonSynthetic pineal tetrapeptideUnapproved | Epithalon Synthetic Tetrapeptide (AGAG)EpithalonAla-Glu-Asp-GlyPineal Tetrapeptide | Pineal tetrapeptide; proposed telomerase effects (cell studies) | AEDG | C14H22N4O9390.3 g/mol | CAS 307297-39-8PubChem CID 219042UNII O65P17785G |
| ExenatideFDA-approved peptide medicineApproved Medicine | ByettaBydureonSynthetic Exendin-4AC2993 | GLP-1 receptor agonist (exendin-4) | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 | C184H282N50O60S4186.6 g/mol | CAS 141732-76-5PubChem CID 45588096UNII 9P1872D4OL |
| GHK-CuEndogenous copper tripeptide complexUnapproved | Copper Tripeptide-1Glycyl-L-histidyl-L-lysine copperCopper peptideGHK copper complex | Copper-binding tripeptide; proposed connective-tissue and gene-expression effects | GHK:Cu | C14H22N6O4·Cu401.9 g/mol | CAS 89030-95-5PubChem CID 71587328UNII 6BJQ43T1I9Identifiers are for prezatide copper, the 1:1 copper complex of GHK (FDA GSRS and PubChem). CAS 49557-75-7, often quoted for GHK-Cu, is not registered by FDA. |
| GhrelinEndogenous peptide hormoneInvestigational | Acylated Ghrelin (Hunger Hormone)Acylated ghrelinMotilin-related peptideGrowth hormone secretagogue hormone | Ghrelin receptor (GHS-R1a); native ligand | GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPR | C149H249N47O423370.9 g/mol | CAS 258279-04-8PubChem CID 16133832UNII UXG268Q86R |
| GHRP-2Synthetic growth hormone secretagogue (GHS-R1a agonist)Unapproved | Pralmorelin (Growth Hormone-Releasing Peptide-2)PralmorelinKP-102GHRP KakenD-Ala-D-2Nal-Ala-Trp-D-Phe-Lys-NH2 | Ghrelin receptor (GHS-R1a) agonist | (D-A)-(D-2Nal)-A-W-(D-F)-K-NH2 | C45H55N9O6818.0 g/mol | CAS 158861-67-7PubChem CID 6918245UNII E6S6E1F19M |
| GHRP-6Synthetic growth hormone secretagogue (GHS-R1a agonist)Unapproved | Growth Hormone-Releasing Peptide-6Growth hormone-releasing hexapeptideSKF-110679His-D-Trp-Ala-Trp-D-Phe-Lys-NH2[His1,Lys6]GHRP | Ghrelin receptor (GHS-R1a) agonist | H-(D-W)-A-W-(D-F)-K-NH2 | C46H56N12O6873.0 g/mol | CAS 87616-84-0PubChem CID 9919153UNII 4H7N4I6X6A |
| GIPEndogenous incretin peptide hormoneInvestigational | Glucose-Dependent Insulinotropic PolypeptideGastric Inhibitory PolypeptideIncretin hormone GIPEnteroendocrine K-cell peptide | GIP receptor; native incretin hormone | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ | C226H338N60O66S4983.5 g/mol | CAS 100040-31-1PubChem CID 131954558UNII 1O4H75S7H2Identifiers are for human GIP(1-42). |
| GLP-1Endogenous incretin peptide hormoneInvestigational | Glucagon-Like Peptide-1 (Endogenous 7-36 Amide)GLP-1(7-36)amideIncretin hormoneProglucagon fragment 78-107 | GLP-1 receptor; native incretin hormone | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | C149H226N40O453297.7 g/mol | CAS 107444-51-9PubChem CID 16133831UNII 0JS9125PIZIdentifiers are for GLP-1(7-36) amide, the main active circulating form. |
| GlucagonFDA-approved peptide medicineApproved Medicine | GlucaGenBaqsimiPancreatic A-cell hormone | Glucagon receptor agonist | HSQGTFTSDYSKYLDSRRAQDFVQWLMNT | C153H225N43O49S3482.8 g/mol | CAS 16941-32-5PubChem CID 16132283UNII 76LA80IG2GIdentifiers are for glucagon; glucagon hydrochloride carries UNII 1H87NVF4DB. |
| GonadorelinSynthetic native GnRH; discontinued FDA-approved human medicineUnapproved | GnRHLHRHGonadotropin-releasing hormoneFactrelLutrepulseLutrelef | GnRH receptor agonist (native GnRH) | pEHWSYGLRPG-NH2 | C55H75N17O131182.3 g/mol | CAS 33515-09-2PubChem CID 638793UNII 9O7312W37G |
| HexarelinSynthetic growth hormone secretagogue (GHS-R1a agonist)Unapproved | ExamorelinEP-23905MF-6003His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2 | Ghrelin receptor (GHS-R1a) agonist | H-(D-2-Me-W)-A-W-(D-F)-K-NH2 | C47H58N12O6887.0 g/mol | CAS 140703-51-1PubChem CID 6918297UNII 09QF37C617 |
| InsulinFDA-approved peptide medicineApproved Medicine | Human Insulin (Regular / NPH / Analogues)HumulinNovolinRecombinant Human InsulinPancreatic beta-cell peptide hormone | Insulin receptor (tyrosine kinase) agonist | A:GIVEQCCTSICSLYQLENYCN / B:FVNQHLCGSHLVEALYLVCGERGFFYTPKT | C257H383N65O77S65807.6 g/mol | CAS 11061-68-0PubChem CID 118984375UNII 1Y17CTI5SRIdentifiers are for human insulin. Insulin analogues and animal insulins have their own identifiers. |
| IpamorelinGrowth hormone secretagogue (GHSR agonist)Unapproved | NNC 26-0161Aib-His-D-2-Nal-D-Phe-Lys-NH2 | Ghrelin receptor (GHS-R1a) agonist | Aib-H-D-2Nal-D-F-K-NH2 | C38H49N9O5711.9 g/mol | CAS 170851-70-4PubChem CID 9831659UNII Y9M3S784Z6 |
| KisspeptinEndogenous reproductive neuropeptide hormoneInvestigational | Kisspeptin-10Kisspeptin-54MetastinKP-10KISS1-derived peptides | KISS1 receptor (GPR54) agonist | YNWNSFGLRF-NH2 | C63H83N17O141302.4 g/mol | CAS 374675-21-5PubChem CID 25240297UNII FS1N52VS3S |
| KPVSynthetic peptide fragmentUnapproved | Lysine-Proline-Valine Tripeptidealpha-MSH (11-13)Lys-Pro-ValC-terminal MSH fragment | α-MSH C-terminal fragment; NF-κB inhibition (cell studies) | KPV | C16H30N4O4342.43 g/mol | CAS 2828433-34-5PubChem CID 9949939UNII HX2YJ5Z225FDA registers only the acetate salt of KPV; the UNII and CAS shown are for Lys-Pro-Val acetate. Formula and weight are for the free base. |
| LanreotideFDA-approved peptide medicineApproved Medicine | SomatulineSomatuline DepotBIM-23014 | Somatostatin receptor agonist | D-2Nal-c[CY-D-Trp-KVC]-T-NH2 | C54H69N11O10S21096.3 g/mol | CAS 108736-35-2PubChem CID 6918011UNII 0G3DE8943YIdentifiers are for the free base; the medicine contains lanreotide acetate (UNII IEU56G3J9C). |
| LarazotideInvestigational oral tight-junction regulator peptideInvestigational | Larazotide acetateAT-1001AT1001 | Tight-junction regulator (mechanism disputed) | GGVLVQPG | C32H55N9O10725.8 g/mol (free base) | CAS 258818-34-7PubChem CID 9810532UNII ZN3R5560ZVIdentifiers are for the free base; trials used larazotide acetate (UNII FO8S2IW40N). |
| LiraglutideFDA-approved peptide medicineApproved Medicine | VictozaSaxendaNN2211 | GLP-1 receptor agonist | H-AEGTFTSDVSSYLEGQAAK(palmitoyl)EFIAWLVRGRG | C172H265N43O513751.2 g/mol | CAS 204656-20-2PubChem CID 16134956UNII 839I73S42A |
| LixisenatideFDA-approved GLP-1 receptor agonist (U.S. supply now only in the Soliqua combination)Approved Medicine | AdlyxinLyxumiaAVE0010ZP10Soliqua 100/33 (with insulin glargine) | GLP-1 receptor agonist | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | C215H347N61O65S4858 g/mol | CAS 320367-13-3PubChem CID 90472060UNII 74O62BB01U |
| LL-37Endogenous antimicrobial peptide (AMP)Unapproved | Human Cathelicidin Antimicrobial PeptidehCAP-18 fragmentCAMP 134-170Cathelicidin LL-37 | Antimicrobial peptide; FPR2 (FPRL1) chemotactic agonist | [LL-37, 37 aa] | C205H340N60O534493.3 g/mol | CAS 154947-66-7PubChem CID 16198951UNII 3DD771JO2H |
| MatrixylCosmetic lipopeptide ingredient (not a drug)Unapproved | Palmitoyl Pentapeptide-4 (Pal-KTTKS)Palmitoyl Pentapeptide-4Pal-KTTKSPalmitoyl Pentapeptide-3Pal-Lys-Thr-Thr-Lys-Ser | Collagen-fragment signal peptide (cosmetic); no receptor defined | Pal-KTTKS | C39H75N7O10802.1 g/mol | CAS 214047-00-4PubChem CID 9897237UNII KK181SM5JG |
| MazdutideInvestigational in the U.S.; approved in ChinaInvestigational | IBI362IBI-362LY3305677LY-3305677 | GLP-1 and glucagon receptor dual agonist | not assigned | C207H317N45O654476 g/mol (PubChem computed) | CAS 2259884-03-0PubChem CID 167312357UNII MB76Z4IBZ5 |
| Melanotan IIUnapproved synthetic melanocortin receptor agonistUnapproved | MT-IIMelanotan-IIMelanotan 2 | Non-selective melanocortin receptor agonist | Ac-Nle-c[DHfRWK]-NH2 | C50H69N15O91024.2 g/mol | CAS 121062-08-6PubChem CID 92432UNII UPF5CJ93X7Identifiers are for the free base; melanotan II acetate carries UNII WYE6CXB7CH. |
| MOTS-cMitochondrial-derived peptide (MDP)Unapproved | Mitochondrial ORF of the 12S rRNA type-cMitochondrial-derived peptideMDP MOTS-c | AMPK pathway activation (proposed; cell and animal studies) | MRWQEMGYIFYPRKLR | C101H152N28O22S22174.6 g/mol | CAS 1627580-64-6PubChem CID 146675088UNII A5CV6JFB78 |
| OctreotideFDA-approved peptide medicineApproved Medicine | SandostatinSandostatin LARSMS 201-995 | Somatostatin receptor agonist (SSTR2, SSTR5) | D-Phe-c[Cys-Phe-D-Trp-Lys-Thr-Cys]-Thr-ol | C49H66N10O10S21019.2 g/mol | CAS 83150-76-9PubChem CID 448601UNII RWM8CCW8GP |
| OxytocinFDA-approved peptide medicineApproved Medicine | PitocinSyntocinonEndogenous nonapeptide neurohormone | Oxytocin receptor agonist | CYIQNCPLG-NH2 | C43H66N12O12S21007.2 g/mol | CAS 50-56-6PubChem CID 439302UNII 1JQS135EYNIdentifiers are for the free base; oxytocin acetate carries UNII 4NR672T8NL. |
| PemvidutideInvestigational peptide medicineInvestigational | ALT-801GLP-1/glucagon dual agonist | GLP-1 and glucagon receptor dual agonist | not assigned | not assigned | CAS 2538014-94-5PubChem not assignedUNII A35F525WBGPubChem has no compound record yet; the UNII and CAS are from FDA GSRS. |
| Peptide YYEndogenous satiety peptide hormoneInvestigational | PYYPYY(3-36)Ileal brake peptide hormone | Neuropeptide Y Y2 receptor (PYY 3-36) | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 | C180H279N53O544049.5 g/mol | CAS 123583-37-9PubChem CID 59404585UNII 7PQZ90ULIRIdentifiers are for PYY(3-36), the main circulating form. Full-length PYY(1-36) carries UNII T2670C12I5 and CAS 118997-30-1. |
| PramlintideFDA-approved peptide medicineApproved Medicine | SymlinSynthetic Amylin AnalogueTri-pro-amylin | Amylin receptor agonist (amylin analogue) | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 | C171H267N51O53S23949.4 g/mol | CAS 151126-32-8PubChem CID 70691388UNII D3FM8FA78TIdentifiers are for the free base. The approved medicine contains pramlintide acetate (UNII 726I6TE06G). |
| RetatrutideInvestigational peptide medicineInvestigational | LY3437943GIP/GLP-1/glucagon triple agonist | GIP, GLP-1 and glucagon receptor triple agonist | not assigned | not assigned | CAS 2381089-83-2PubChem not assignedUNII NOP2Y096GVIdentifiers are for the free base; retatrutide sodium carries UNII LQ42M82ZU6. PubChem has no compound record yet. |
| SelankSynthetic regulatory neuropeptideUnapproved | Heptapeptide Selank (Tuftsin-Derived Analogue)TP-7Thr-Lys-Pro-Arg-Pro-Gly-Pro | Tuftsin analogue; proposed GABA-A receptor modulation | TKPRPGP | C33H57N11O9751.9 g/mol | CAS 129954-34-3PubChem CID 11765600UNII TS9JR8EP1GIdentifiers are for the free base; selank diacetate carries UNII Q94Z9E92UU. |
| SemaglutideFDA-approved peptide medicineApproved Medicine | OzempicWegovyRybelsusNN9535 | GLP-1 receptor agonist | H-Aib-EGTFTSDVSSYLEGQAAK(diacid)EFIAWLVRGRG | C187H291N45O594113.6 g/mol | CAS 910463-68-2PubChem CID 56843331UNII 53AXN4NNHX |
| SemaxSynthetic regulatory neuropeptideUnapproved | Heptapeptide Semax (ACTH 4-7 Pro-Gly-Pro)ACTH(4-7)-PGPMet-Glu-His-Phe-Pro-Gly-Pro | ACTH(4-7) analogue; proposed BDNF/TrkB effects | MEHFPGP | C37H51N9O10S813.9 g/mol | CAS 80714-61-0PubChem CID 122178UNII I5FAL2585H |
| SermorelinDiscontinued FDA-approved GHRH analogueUnapproved | GerefGHRH(1-29)NH2GRF(1-29)NH2Groliberin | GHRH receptor agonist (GHRH 1-29) | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 | C149H246N44O42S3357.9 g/mol | CAS 86168-78-7PubChem CID 16132413UNII 89243S03TE |
| SetmelanotideFDA-approved MC4 receptor agonist for rare genetic and hypothalamic obesityApproved Medicine | ImcivreeRM-493BIM-22493 | MC4 receptor agonist | Ac-R-c[C-dA-H-dF-R-W-C]-NH2 | C49H68N18O9S21117.3 g/mol | CAS 920014-72-8PubChem CID 11993702UNII N7T15V1FUYIdentifiers are for the free base. The approved medicine contains setmelanotide acetate (UNII 224I1W20I7). |
| SNAP-8Cosmetic peptide ingredient (not a drug)Unapproved | Acetyl Octapeptide-3Acetyl Glutamyl Heptapeptide-3Acetyl Octapeptide-1Ac-EEMQRRAD-NH2 | SNAP-25 mimicry (proposed; cosmetic) | Ac-EEMQRRAD-NH2 | C41H70N16O16S1075.2 g/mol | CAS 868844-74-0PubChem CID 76283482UNII 8K14HJF88S |
| SurvodutideInvestigational peptide medicineInvestigational | BI 456906BI456906glucagon/GLP-1 dual agonist | GLP-1 and glucagon receptor dual agonist | not assigned | C192H289N47O614232 g/mol (PubChem computed) | CAS 2805997-46-8PubChem CID 171378821UNII 2ALA66NS64 |
| TB-500Synthetic research peptideUnapproved | Thymosin Beta-4 Synthetic HeptapeptideAc-LKKTETQN-acetylated thymosin beta-4 fragment | Actin-binding fragment of thymosin β4; no receptor | Ac-LKKTETQ | C38H68N10O14889.0 g/mol | CAS 885340-08-9PubChem CID 62707662UNII QHK6Z47GTGIdentifiers are for the TB-500 fragment (Ac-LKKTETQ). Full-length thymosin beta-4 is a different substance (CAS 77591-33-4). |
| TeriparatideFDA-approved peptide medicineApproved Medicine | ForteorhPTH(1-34)Recombinant Human Parathyroid Hormone 1-34 | PTH1 receptor agonist (PTH 1-34) | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF | C181H291N55O51S24117.8 g/mol | CAS 52232-67-4PubChem CID 16133850UNII 10T9CSU89IIdentifiers are for the free base; teriparatide acetate carries UNII 9959P4V12N. |
| TesamorelinFDA-approved peptide medicineApproved Medicine | EgriftaEgrifta SVTH9507trans-3-hexenoyl-GHRH | GHRH receptor agonist | Hexenoyl-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 | C221H366N72O67S5135.8 g/mol | CAS 218949-48-5PubChem CID 16137828UNII MQG94M5EEOIdentifiers are for the free base. The approved medicine contains tesamorelin acetate (UNII LGW5H38VE3). |
| Thymosin Alpha-1Immunomodulatory peptide; prescription medicine in some countries, not FDA approvedUnapproved | Thymalfasin (Zadaxin)ThymalfasinZadaxinThymosin α1Tα1Ta1 | Immunomodulator; Toll-like receptor signalling | Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN | C129H215N33O553108.3 g/mol | CAS 62304-98-7PubChem CID 16130571UNII W0B22ISQ1C |
| TirzepatideFDA-approved peptide medicineApproved Medicine | MounjaroZepboundDual GIP/GLP-1 RALY3298176 | GIP and GLP-1 receptor dual agonist | Y-Aib-EGTFTSDYSI-Aib-LDKIAQK(diacid)AFVQWLIAGGPSSGAPPPS | C225H348N48O684813.5 g/mol | CAS 2023788-19-2PubChem CID 166567236UNII OYN3CCI6QE |
| VasopressinFDA-approved peptide medicineApproved Medicine | Arginine Vasopressin (Vasostrict / AVP)VasostrictPitressinAntidiuretic HormoneADHArgipressin | Vasopressin V1a and V2 receptor agonist | CYFQNCPRG-NH2 | C46H65N15O12S21084.2 g/mol | CAS 113-79-1PubChem CID 644077UNII Y4907O6MFDIdentifiers are for argipressin (arginine vasopressin), the human form used in U.S. medicines. "Vasopressin, unspecified" (argipressin or lypressin) carries UNII Y87Y826H08 and CAS 11000-17-2. |
| VIP (Vasoactive Intestinal Peptide)Endogenous neuropeptide; investigational drug (aviptadil) in the U.S.Investigational | Vasoactive Intestinal Peptide (aviptadil)AviptadilVasoactive intestinal polypeptideRLF-100ZyesamiInvicorp (aviptadil with phentolamine) | VPAC1 and VPAC2 receptor agonist | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 | C147H238N44O42S3325.8 g/mol | CAS 40077-57-4PubChem CID 16140438UNII A67JUW790C |
How to use the identifiers
- Several names, one molecule. A peptide can carry a development code (LY3298176), a generic name (tirzepatide) and brand names (Mounjaro, Zepbound). The code and generic name identify the molecule; a brand name identifies one approved product. Each row lists the names we have met in the literature, labels and registries.
- CAS number. The Chemical Abstracts Service registry number for the substance. Salts and the free base have different CAS numbers; where a profile gives one form, it is the one shown here.
- PubChem CID. The compound record at the U.S. National Library of Medicine, which carries the structure, computed formula and weight and the synonyms the record has collected. Some protein-sized medicines (such as dulaglutide) have no PubChem compound record.
- UNII. FDA's Unique Ingredient Identifier, used on U.S. drug labels. It links to the substance record in FDA's Global Substance Registration System.
- Sequence, formula and weight describe the molecule in its stated form. Weights are rounded; for large modified peptides the value is the one computed by PubChem.
- Primary target or action condenses the mechanism section of each profile, where the sources are. "Proposed" means the mechanism has been shown only in cells or animals.
An identifier describes a molecule. It does not show that a product sold under that name contains it, is pure, or has any benefit. Products sold online under these names are not approved medicines, even when they share a name with one. See approved vs unapproved peptides and what a certificate of analysis can prove.
How the identifiers were checked
On 13 October 2026 every PubChem CID was queried against the PubChem API to confirm the record's title, molecular formula and the CAS numbers it lists, and every UNII was queried against FDA's Global Substance Registration System (GSRS) to confirm the substance name and its registered CAS numbers. The check found that earlier versions of 25 profiles carried UNII codes that do not exist in FDA's registry, and that 9 CAS numbers belonged to a different form or a different substance. All were replaced with the registered values, 4 missing UNIIs and 3 missing CAS numbers were added, and where a profile describes the free base while the medicine uses a salt, both identifiers are now stated. Entries that could not be confirmed in either source are marked "not assigned" rather than guessed. Corrections are welcome through our corrections policy.
Cite or link to this page
Reference
Inside Peptides. (2026, October 13). Peptide Name Index. https://insidepeptides.org/tools/peptide-name-index/HTML link
<a href="https://insidepeptides.org/tools/peptide-name-index/">Peptide Name Index</a> (Inside Peptides)