Inside Peptides
Search
Menu

Teriparatide

What it is. What the evidence says.

A prescription fragment of parathyroid hormone that stimulates new bone formation.

Strong EvidenceApproved Medicine

Predominant research setting. Clinical confidence is claim-specific.

Updated Scientific review pending
Start with the basics Regulatory status ↓
Sequence diagram and chemical structure information for Teriparatide.
Teriparatide Chemical Structure & Sequence · Inside Peptides Scientific Library
Compound
Teriparatide
Human effectiveness
Landmark Phase 3 trials establish marked reductions in vertebral and non-vertebral fractures
Regulatory status
FDA-Approved Medicine
START HERE · PLAIN LANGUAGE

Teriparatide: the basics

What is it?

A prescription fragment of parathyroid hormone that stimulates new bone formation.

Research paper ↗

What do people claim it helps with?

Reducing fracture risk in high-risk osteoporosis is supported. Claims about routine sports-injury recovery or general stronger bones go beyond that indication.

What has research actually shown?

Controlled trials in osteoporosis found increased bone density and fewer fractures. The benefit applies to studied osteoporosis populations, not every bone injury.

Research paper ↗

Has this been demonstrated in people?

Demonstrated in people, including controlled clinical trials for the uses described here. Evidence for one diagnosis does not establish benefit for every other claim.

Research paper ↗

What side effects, risks and unknowns should I understand?

Nausea, dizziness and leg cramps can occur. Calcium can rise and kidney-stone risk needs consideration. People at increased baseline risk of bone cancer generally should avoid it under label guidance.

Prescribing information ↗

Is it an approved medicine?

Yes. FDA-approved teriparatide products treat specified forms of osteoporosis in patients at high fracture risk.

Prescribing information ↗

Approval here means U.S. FDA approval and applies to a particular product, formulation and use. This is a starting overview, not a complete side-effect list. Sources checked 10 October 2026; independent scientific review pending.

How is it used or studied?

Prescription injection as part of a clinician-managed osteoporosis plan.

Different routes and formulations can have different effects. A study of one product does not validate every product with the same peptide name.

A common misunderstanding

More bone density is one measurement; fracture reduction is a separate, more direct patient outcome.

What should I ask a clinician?
  • What diagnosis or goal are we trying to address, and what established options are available?
  • Was the expected benefit shown in people like me, using this exact product?
  • How could my medicines, health conditions or pregnancy plans affect the risks?
  • What monitoring is needed, and what would tell us the treatment is helping or should be stopped?
What do the research words mean?
Peptide
A short chain of amino acids, the building blocks of proteins.
Preclinical
Research in cells, tissues or animals before dependable treatment evidence in people.
Controlled trial
A study comparing a treatment with another treatment or a placebo to help separate its effects from other explanations.
Biomarker
A measurement, such as a hormone level. A change does not necessarily mean someone feels better or lives longer.
THE AVAILABLE RESEARCH

Teriparatide Evidence & Clinical Profile

Human Clinical Evidence

Established Clinical Trials

Teriparatide has been investigated in clinical contexts. Patient outcomes must be evaluated against study size, design, and control cohorts.

Preclinical & Pharmacological Data

Laboratory & In Vivo Assays

Cellular and animal disease models examine receptor binding affinities and signaling cascades, which require human confirmation.

Understand our evidence labels →

IDENTITY & STRUCTURE

What is Teriparatide?

Teriparatide (Forteo / rhPTH 1-34) is An FDA-approved recombinant human parathyroid hormone fragment (rhPTH 1-34). The first approved bone anabolic medicine, stimulating osteoblast activity and new trabecular bone formation to reduce osteoporotic fracture risk. Aliases include: Forteo, rhPTH(1-34), Recombinant Human Parathyroid Hormone 1-34.

Chemical sequence and molecular parameters of Teriparatide
Primary sequence schematic · Inside Peptides Molecular Database
Chemical reference
Sequence (one-letter)
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Molecular formula
C181H291N55O51S2
Molecular weight
4117.8 g/mol
CAS Number
52232-67-4
UNII Code
10T9CSU89I
PubChem CID
16133850

Identifiers are for the free base; teriparatide acetate carries UNII 9959P4V12N.

Identifiers checked against PubChem and FDA's Global Substance Registration System on 13 October 2026. FDA substance record ↗ · PubChem record ↗ See all names and codes in the peptide name index.

HUMAN RESEARCH

Clinical Trials & Human Cohorts

Human research can examine tolerability, symptoms or patient outcomes. The design and comparator determine what each result can establish.

Double-blind multinational RCT2001

Effects of Parathyroid Hormone (1-34) on Fractures and Bone Density in Postmenopausal Women [1]

n = 16371637 postmenopausal women with prior vertebral fractures

What was reported

New vertebral fractures fell from 14% with placebo to 5% and 4% in the two PTH(1-34) groups (relative risks 0.35 and 0.31); nonvertebral fragility fractures fell from 6% to 3% (relative risks 0.47 and 0.46).

What limits the conclusion

Median observation of 21 months in women with prior vertebral fractures; the higher dose had more side effects without further fracture benefit.

Read primary source ↗ (external website)
18-month double-blind randomized active comparator RCT2007

Teriparatide Versus Alendronate in Glucocorticoid-Induced Osteoporosis [2]

n = 428428 women and men with osteoporosis on long-term glucocorticoids

What was reported

Lumbar spine BMD rose more with teriparatide than alendronate (7.2% vs 3.4%), with fewer new vertebral fractures (0.6% vs 6.1%); nonvertebral fractures were similar.

What limits the conclusion

More teriparatide patients had at least one elevated serum calcium measurement; daily injections required.

Read primary source ↗ (external website)
MECHANISMS OF ACTION

How the compound may work

Mechanisms describe how Teriparatide may affect biological processes. Laboratory findings and patient outcomes answer different questions.

01
Osteoblast cell lineage (in vitro and mouse studies)

Intermittent PTH1R Activation

Intermittent PTH increases osteoblast number, in part by activating survival signaling and delaying osteoblast apoptosis, so bone formation exceeds the bone removed by osteoclasts. [3]

02
Genetically modified mice

Growth Factor and Wnt Signaling

Mouse genetic studies suggest the anabolic effect of intermittent PTH requires IGF-I and FGF-2, and perhaps Wnt signaling. [3]

RESEARCH AREAS

Areas Being Studied

These research topics reflect active areas of scientific exploration, distinct from unverified commercial marketing claims.

Registrational Phase 3 program

Postmenopausal Osteoporosis

Rapid restoration of trabecular architecture and bone mineral density. [1]

Active-comparator Phase 3 RCT

Glucocorticoid-Induced Osteoporosis

Compared with alendronate in patients on long-term glucocorticoids, with greater spine BMD gains and fewer new vertebral fractures. [2]

AT A GLANCE

Compare the study designs.

Overview of Key Teriparatide Studies: clinical and preclinical records
Study Design / sample Outcome type Key limitation
Fracture Prevention Trial · 2001 [1] Double-blind multinational RCT
n = 1637		 Clinical endpoint evaluation Median observation of 21 months in women with prior vertebral fractures; the higher dose had more side effects without further fracture benefit.
Glucocorticoid Osteoporosis Trial · 2007 [2] 18-month double-blind randomized active comparator RCT
n = 428		 Clinical endpoint evaluation More teriparatide patients had at least one elevated serum calcium measurement; daily injections required.
FDA & SAFETY

Regulatory Status & Clinical Safety

Regulatory Classification

FDA approved (NDA 021318) for severe osteoporosis in postmenopausal women and men at high risk.

Safety Realities & Impurities

Safety depends on the molecule, formulation, route and evidence. A laboratory purity measurement alone cannot establish safety for human use.

REGISTRY CHECK

Clinical Trials Registry Records

Official registry records from ClinicalTrials.gov. Study registration does not imply government endorsement or guaranteed efficacy.

COMPETITIVE SPORT

WADA & Anti-Doping Regulations

Not Prohibited

WADA Anti-Doping Status

Teriparatide is not prohibited under current World Anti-Doping Agency (WADA) regulations. However, athletes must ensure unregulated preparations or unverified vendor products do not violate Section S0 (Non-approved substances). Last verified: October 2026.

SELECTED MILESTONES

Research Timeline

  1. 2001

    NEJM Landmark Trial

    Neer et al. demonstrate fracture risk reduction. [1]

  2. 2002

    FDA Approval

    FDA approves Forteo under NDA 021318. [5]

  3. 2020

    Black Box Removal

    FDA removes osteosarcoma black box warning based on post-marketing registry data. [5]

OPEN QUESTIONS

What Researchers Still Don't Know

Long-term safety profiles

Multi-year observational data in broader heterogeneous cohorts remains uncharacterized.

Optimal dose-response thresholds

Comparative trials optimizing minimal effective exposure versus adverse event rates.

Formulation bioavailability

Differences between oral, subcutaneous, and modified peptide delivery vehicles.

TRACEABLE SOURCES

References

Primary sources verified against PubMed / NLM and regulatory databases.

  1. Landmark RCT

    Effect of parathyroid hormone (1-34) on fractures and bone mineral density in postmenopausal women with osteoporosis ↗ (external website)

    Neer RM et al. · N Engl J Med · 2001
  2. Phase 3 Active Comparator RCT

    Teriparatide or alendronate in glucocorticoid-induced osteoporosis ↗ (external website)

    Saag KG et al. · N Engl J Med · 2007
  3. Mechanism Review

    Molecular and cellular mechanisms of the anabolic effect of intermittent PTH ↗ (external website)

    Jilka RL · Bone · 2007
  4. Regulatory

    Forteo (Teriparatide) FDA Prescribing Information ↗ (external website)

    FDA CDER · 2020
  5. Regulatory

    Drugs@FDA: Forteo (teriparatide injection), NDA 021318 ↗ (external website)

    U.S. Food and Drug Administration · undefined