GIP: the basics
What is it?
A gut hormone released after eating that helps regulate insulin and other metabolic signals.
Research paper 1 ↗Research paper 2 ↗What do people claim it helps with?
Better metabolic health and weight control. GIP biology helps inform drug development, but native GIP is not a proven standalone weight-loss treatment.
What has research actually shown?
Human experiments show that its effects on insulin and glucagon depend on blood-sugar levels and diabetes status. Those responses do not establish long-term weight or health benefits from taking GIP.
Research paper 1 ↗Research paper 2 ↗Has this been demonstrated in people?
Human physiology and small human administration studies, alongside laboratory and animal research. These studies do not establish a routine treatment for the claims listed here.
Research paper 1 ↗Research paper 2 ↗What side effects, risks and unknowns should I understand?
It changes hormone and blood-sugar signaling. Long-term treatment safety and interactions for native GIP are not established.
Research paper 1 ↗Research paper 2 ↗Is it an approved medicine?
The native hormone described here is not an FDA-approved standalone medicine. Medicines that act on similar pathways are different products with their own approvals.
Research paper 1 ↗Research paper 2 ↗Approval here means U.S. FDA approval and applies to a particular product, formulation and use. This is a starting overview, not a complete side-effect list. Sources checked 10 October 2026; independent scientific review pending.
How is it used or studied?
Research administration differs from approved medicines that activate the GIP receptor alongside other receptors.
Different routes and formulations can have different effects. A study of one product does not validate every product with the same peptide name.
A common misunderstanding
Tirzepatide acts on GIP and GLP-1 receptors; its benefits cannot be attributed to native GIP alone.
What should I ask a clinician?
- What diagnosis or goal are we trying to address, and what established options are available?
- Was the expected benefit shown in people like me, using this exact product?
- How could my medicines, health conditions or pregnancy plans affect the risks?
- What monitoring is needed, and what would tell us the treatment is helping or should be stopped?
What do the research words mean?
- Peptide
- A short chain of amino acids, the building blocks of proteins.
- Preclinical
- Research in cells, tissues or animals before dependable treatment evidence in people.
- Controlled trial
- A study comparing a treatment with another treatment or a placebo to help separate its effects from other explanations.
- Biomarker
- A measurement, such as a hormone level. A change does not necessarily mean someone feels better or lives longer.
GIP Evidence & Clinical Profile
Human Study Limits
GIP has been investigated in clinical contexts. Patient outcomes must be evaluated against study size, design, and control cohorts.
Laboratory & In Vivo Assays
Cellular and animal disease models examine receptor binding affinities and signaling cascades, which require human confirmation.
What is GIP?
Glucose-Dependent Insulinotropic Polypeptide is An endogenous 42-amino-acid incretin peptide hormone secreted by duodenal and jejunal enteroendocrine K-cells. While historically termed gastric inhibitory polypeptide, its primary physiological role is stimulating insulin release and regulating adipose tissue lipid deposition, representing the co-target of tirzepatide. Aliases include: Gastric Inhibitory Polypeptide, Incretin hormone GIP, Enteroendocrine K-cell peptide.
- Sequence (one-letter)
- YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
- Molecular formula
- C226H338N60O66S
- Molecular weight
- 4983.5 g/mol
- CAS Number
- 100040-31-1
- UNII Code
- 1O4H75S7H2
- PubChem CID
- 131954558
Identifiers are for human GIP(1-42).
Identifiers checked against PubChem and FDA's Global Substance Registration System on 13 October 2026. FDA substance record ↗ · PubChem record ↗ See all names and codes in the peptide name index.
Clinical Trials & Human Cohorts
Human research can examine tolerability, symptoms or patient outcomes. The design and comparator determine what each result can establish.
Preserved incretin activity of glucagon-like peptide 1 [7-36 amide] but not of synthetic human gastric inhibitory polypeptide in patients with type-2 diabetes mellitus [1]
What was reported
GIP and GLP-1 both augmented insulin secretion, but GIP's maximum effect was 54% lower in type 2 diabetes than in normal subjects, whereas GLP-1 retained much of its insulinotropic activity.
What limits the conclusion
Small acute infusion study in mild type 2 diabetes.
Glucose-dependent insulinotropic polypeptide: a bifunctional glucose-dependent regulator of glucagon and insulin secretion in humans [2]
What was reported
GIP raised glucagon during hypoglycemia and euglycemia, had no effect on glucagon during hyperglycemia, and more than doubled insulin secretion during hyperglycemia.
What limits the conclusion
Small acute study in healthy young men; chronic and disease-state effects not tested.
How the compound may work
Mechanisms describe how GIP may affect biological processes. Laboratory findings and patient outcomes answer different questions.
Incretin Receptor Signaling in Beta Cells
Incretin-receptor activation leads to glucose-dependent insulin secretion, induction of beta-cell proliferation and enhanced resistance to apoptosis. [4]
Adipose Tissue Nutrient Partitioning
With a hyperinsulinemic-hyperglycemic clamp, GIP increased subcutaneous adipose tissue blood flow, triacylglycerol hydrolysis and glucose uptake while lowering free fatty acid output. [3]
Areas Being Studied
These research topics reflect active areas of scientific exploration, distinct from unverified commercial marketing claims.
Entero-Insular Axis & Diabetes Biology
In healthy volunteers, GIP and GLP-1 infused together increased beta-cell responses more than either alone (additive interaction). [5]
Adipose Tissue Lipid Storage
GIP with hyperinsulinemia increased fatty acid re-esterification and triacylglycerol deposition in abdominal subcutaneous fat. [3]
Compare the study designs.
| Study | Design / sample | Outcome type | Key limitation |
|---|---|---|---|
| Defective Incretin Effect · 1993 [1] | Hyperglycemic clamp infusion study n = 18 |
Clinical endpoint evaluation | Small acute infusion study in mild type 2 diabetes. |
| Glucagon Modulation Study · 2011 [2] | Randomized double-blind saline-controlled infusion study n = 10 |
Clinical endpoint evaluation | Small acute study in healthy young men; chronic and disease-state effects not tested. |
Regulatory Status & Clinical Safety
Regulatory Classification
Endogenous biological molecule. Dual agonists targeting GIPR (tirzepatide) are FDA approved.
Safety Realities & Impurities
Safety depends on the molecule, formulation, route and evidence. A laboratory purity measurement alone cannot establish safety for human use.
Clinical Trials Registry Records
Official registry records from ClinicalTrials.gov. Study registration does not imply government endorsement or guaranteed efficacy.
WADA & Anti-Doping Regulations
WADA Anti-Doping Status
GIP is not prohibited under current World Anti-Doping Agency (WADA) regulations. However, athletes must ensure unregulated preparations or unverified vendor products do not violate Section S0 (Non-approved substances). Last verified: October 2026.
Research Timeline
What Researchers Still Don't Know
Long-term safety profiles
Multi-year observational data in broader heterogeneous cohorts remains uncharacterized.
Optimal dose-response thresholds
Comparative trials optimizing minimal effective exposure versus adverse event rates.
Formulation bioavailability
Differences between oral, subcutaneous, and modified peptide delivery vehicles.
References
Primary sources verified against PubMed / NLM and regulatory databases.
- Clamp Infusion Study
- Clinical Infusion Study
- Adipose Biology Study
- Incretin Review
- Clinical Infusion Study
-
Regulatory
Drugs@FDA: Mounjaro (Tirzepatide) NDA 215866 ↗ (external website)