Pramlintide: the basics
What is it?
A prescription medicine that imitates amylin, a hormone normally released with insulin after meals.
Prescribing information ↗What do people claim it helps with?
Better after-meal blood-sugar control in insulin-treated diabetes is a supported use. It is not a general weight-loss treatment.
What has research actually shown?
Human trials show improved glucose control when added to mealtime insulin in selected people with type 1 or type 2 diabetes. It supplements insulin rather than replacing it.
Prescribing information ↗Has this been demonstrated in people?
Demonstrated in people, including controlled clinical trials for the uses described here. Evidence for one diagnosis does not establish benefit for every other claim.
Prescribing information ↗What side effects, risks and unknowns should I understand?
Nausea is common. Severe low blood sugar can occur when used with insulin, particularly in type 1 diabetes. Gastroparesis and inability to recognize low blood sugar are contraindications.
Prescribing information ↗Is it an approved medicine?
Yes. Symlin is FDA-approved as an addition to mealtime insulin in certain people with type 1 or type 2 diabetes who have not reached their glucose goals.
Prescribing information ↗Approval here means U.S. FDA approval and applies to a particular product, formulation and use. This is a starting overview, not a complete side-effect list. Sources checked 10 October 2026; independent scientific review pending.
How is it used or studied?
Prescription injection separate from insulin, requiring clinician-guided changes and glucose monitoring.
Different routes and formulations can have different effects. A study of one product does not validate every product with the same peptide name.
A common misunderstanding
Amylin replacement does not replace the body’s need for insulin.
What should I ask a clinician?
- What diagnosis or goal are we trying to address, and what established options are available?
- Was the expected benefit shown in people like me, using this exact product?
- How could my medicines, health conditions or pregnancy plans affect the risks?
- What monitoring is needed, and what would tell us the treatment is helping or should be stopped?
What do the research words mean?
- Peptide
- A short chain of amino acids, the building blocks of proteins.
- Preclinical
- Research in cells, tissues or animals before dependable treatment evidence in people.
- Controlled trial
- A study comparing a treatment with another treatment or a placebo to help separate its effects from other explanations.
- Biomarker
- A measurement, such as a hormone level. A change does not necessarily mean someone feels better or lives longer.
Pramlintide Evidence & Clinical Profile
Established Clinical Trials
Pramlintide has been investigated in clinical contexts. Patient outcomes must be evaluated against study size, design, and control cohorts.
Laboratory & In Vivo Assays
Cellular and animal disease models examine receptor binding affinities and signaling cascades, which require human confirmation.
What is Pramlintide?
Pramlintide Acetate (Symlin) is An FDA-approved synthetic 37-amino-acid analogue of human islet amyloid polypeptide (amylin). Modified with three proline substitutions at positions 25, 28, and 29 to prevent fibril aggregation while preserving mealtime glucagon suppression. Aliases include: Symlin, Synthetic Amylin Analogue, Tri-pro-amylin.
- Sequence (one-letter)
- KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
- Molecular formula
- C171H267N51O53S2
- Molecular weight
- 3949.4 g/mol
- CAS Number
- 151126-32-8
- UNII Code
- D3FM8FA78T
- PubChem CID
- 70691388
Identifiers are for the free base. The approved medicine contains pramlintide acetate (UNII 726I6TE06G).
Identifiers checked against PubChem and FDA's Global Substance Registration System on 13 October 2026. FDA substance record ↗ · PubChem record ↗ See all names and codes in the peptide name index.
Clinical Trials & Human Cohorts
Human research can examine tolerability, symptoms or patient outcomes. The design and comparator determine what each result can establish.
Pramlintide as an Adjunct to Insulin in Patients with Type 1 Diabetes [1]
What was reported
HbA1c fell 0.67% from baseline to week 13 with pramlintide vs 0.16% with placebo, with a significant placebo-corrected difference sustained through week 52, average weight loss and no increase in the overall severe hypoglycemia event rate.
What limits the conclusion
Mild nausea and anorexia were common in the first weeks; requires preprandial injections in addition to insulin.
Pramlintide and Postprandial Hyperglucagonemia in Type 1 Diabetes [2]
What was reported
Plasma glucagon rose after a standardized meal with placebo plus insulin but not in any pramlintide-treated group.
What limits the conclusion
Surrogate hormonal endpoint in controlled meal challenge setting.
How the compound may work
Mechanisms describe how Pramlintide may affect biological processes. Laboratory findings and patient outcomes answer different questions.
Amylin Mimetic Actions
Like native amylin, which is co-secreted with insulin and deficient in diabetes, pramlintide inhibits glucagon secretion, delays gastric emptying and acts as a satiety agent. [3]
Non-Aggregating Amylin Analog
Human amylin tends to aggregate into amyloid fibers, making it unsuitable as a drug; pramlintide was developed as a stable analog with similar actions and pharmacokinetic properties. [3]
Areas Being Studied
These research topics reflect active areas of scientific exploration, distinct from unverified commercial marketing claims.
Compare the study designs.
| Study | Design / sample | Outcome type | Key limitation |
|---|---|---|---|
| Phase 3 Type 1 Diabetes · 2002 [1] | 52-week multicenter double-blind placebo-controlled RCT n = 480 |
Clinical endpoint evaluation | Mild nausea and anorexia were common in the first weeks; requires preprandial injections in addition to insulin. |
| Postprandial Glucagon Suppression · 2002 [2] | Two randomized double-blind placebo-controlled meal-challenge studies n = 102 |
Clinical endpoint evaluation | Surrogate hormonal endpoint in controlled meal challenge setting. |
Regulatory Status & Clinical Safety
Regulatory Classification
FDA approved (NDA 021332) as Symlin injection; carries boxed warning for severe hypoglycemia with co-administered insulin.
Safety Realities & Impurities
Safety depends on the molecule, formulation, route and evidence. A laboratory purity measurement alone cannot establish safety for human use.
Clinical Trials Registry Records
Official registry records from ClinicalTrials.gov. Study registration does not imply government endorsement or guaranteed efficacy.
An Observational Study Evaluating SYMLIN (Pramlintide Acetate) Injection Use in Insulin Using Patients With Diabetes [1]
- Planned enrollment
- 1873 (patients)
- Posted results
- Available
- Sponsor
- AstraZeneca
- Last updated
- 2012
WADA & Anti-Doping Regulations
WADA Anti-Doping Status
Pramlintide is not prohibited under current World Anti-Doping Agency (WADA) regulations. However, athletes must ensure unregulated preparations or unverified vendor products do not violate Section S0 (Non-approved substances). Last verified: October 2026.
Research Timeline
What Researchers Still Don't Know
Long-term safety profiles
Multi-year observational data in broader heterogeneous cohorts remains uncharacterized.
Optimal dose-response thresholds
Comparative trials optimizing minimal effective exposure versus adverse event rates.
Formulation bioavailability
Differences between oral, subcutaneous, and modified peptide delivery vehicles.
References
Primary sources verified against PubMed / NLM and regulatory databases.
- Phase 3 RCT
- Clinical RCT
-
Pharmacology
Amylin agonists: a novel approach in the treatment of diabetes ↗ (external website)
- Discovery
-
Regulatory
Drugs@FDA: Symlin (pramlintide acetate), NDA 021332 ↗ (external website)