Evidence-Based Summary
LL-37 and KPV represent two complementary arms of human host defense: direct pathogen destruction versus inflammatory resolution. LL-37 is the sole human antimicrobial peptide belonging to the cathelicidin family, cleaved from the 18 kDa pro-protein hCAP18 by proteinase 3 in neutrophils and epithelial cells. Adopting an amphipathic alpha-helical conformation in physiological solutions, the positively charged LL-37 peptide binds electrostatically to negatively charged bacterial lipopolysaccharide (LPS) and phosphatidylglycerol membranes, inserting into the lipid bilayer to form toroidal pores that trigger rapid osmotic lysis of Gram-positive and Gram-negative bacteria. In addition to direct bactericidal activity, LL-37 binds formyl peptide receptor-like 1 (FPRL1/FPR2) to chemoattract neutrophils and T-cells. In contrast, KPV is a tiny 3-amino-acid peptide (Lys-Pro-Val) derived from the C-terminus of alpha-melanocyte-stimulating hormone. KPV is not a pore-forming membrane-lytic agent; instead, it enters cells via the oligopeptide transporter PepT1 to block the phosphorylation and nuclear translocation of NF-κB, shutting down the transcription of pro-inflammatory cytokines (TNF-α, IL-1β, IL-6). In host defense: LL-37 kills the invading microbial pathogen and mobilizes leukocytes, while KPV prevents excessive, tissue-damaging inflammatory hyperactivation. While LL-37 has been evaluated in Phase 2 clinical trials for venous leg ulcer healing, and KPV in preclinical colitis models, neither peptide is an FDA-approved prescription medicine.
Quick Comparison: LL-37 vs KPV
A high-level comparison of molecule class, molecular receptor targets, FDA regulatory approvals, and verified clinical programs.
| Feature | LL-37 | KPV |
|---|---|---|
| Biological classification | Endogenous human cathelicidin antimicrobial peptide | Synthetic C-terminal tripeptide of alpha-MSH |
| Peptide sequence & length | 37 amino acids: [LL-37, 37 aa] (4493.3 Da) | 3 amino acids: Lys-Pro-Val (342.4 Da) |
| Primary immune mechanism | Bacterial membrane permeabilization (Toroidal pore formation) | Intracellular NF-κB nuclear translocation blockade |
| Receptor engagement | Formyl peptide receptor-like 1 (FPRL1/FPR2), P2X7 | Oligopeptide transporter PepT1 (SLC15A1) |
| Direct bactericidal activity | Broad-spectrum (Gram-positive, Gram-negative, enveloped viruses) | Mild/indirect antifungal (C. albicans); primary action is anti-inflammatory |
| Cytokine regulation | Biphasic (Neutralizes LPS; can induce pro-inflammatory chemokines) | Directly suppresses TNF-alpha, IL-1beta, and IL-6 |
| Clinical trial development | Phase 2 trials for chronic venous leg ulcer healing | Preclinical animal colitis and mucosal inflammation models |
| FDA regulatory status | Investigational drug candidate | Unapproved research chemical |
Bacterial Membrane Pore Formation vs Intracellular NF-κB Blockade
The biophysical contrast between physical bacterial lysis and biochemical signal quenching.
LL-37: Electrostatic Membrane Lysis & FPRL1 Chemotaxis
Primary Target: Bacterial lipid bilayers, Formyl peptide receptor-like 1 (FPRL1)
Affinity Profile: High affinity for anionic bacterial phospholipids over zwitterionic mammalian membranes
Carrying a net positive charge of +6, LL-37 binds selectively to anionic bacterial membranes. It aligns parallel to the lipid bilayer, then inserts perpendicular to form 'toroidal pores' that cause rapid depolarization, leakage of cytoplasmic contents, and bacterial cell death. Extracellularly, LL-37 binds FPRL1 on monocytes and neutrophils, directing chemotactic migration into infected tissue planes.
KPV: PepT1 Uptake & IκB-alpha Stabilization
Primary Targets: PepT1 transporter (SLC15A1)
Affinity Profile: High transport affinity for intestinal and immune PepT1
KPV enters cells through PepT1. Inside the cytoplasm, it prevents the phosphorylation and proteasomal degradation of IκB-alpha, keeping the NF-κB transcription factor sequestered away from nuclear DNA promoters. This turns off transcription of pro-inflammatory cytokines (TNF-α, IL-6, IL-1β) and adhesion molecules (ICAM-1), halting destructive leukocyte tissue infiltration.
Investigational Drug Pipeline vs Research Status
The regulatory status of both host defense peptides.
LL-37 Status & Formulations
Not approved by the FDA or EMA for human clinical use.
KPV Status & Formulations
Not approved by the FDA or EMA for human clinical use.
Critical Regulatory Distinction
LL-37 has been investigated under Phase 2 clinical trial IND protocols for non-healing chronic leg ulcers. KPV has not advanced into registrational human clinical programs.
Human Ulcer Trials vs Preclinical Inflammation Models
Contrasting clinical trial data with laboratory mucosal studies.
LL-37: LL-37 Clinical Trial Data (Grönberg et al., Wound Repair Regen 2014)
In a randomized, double-blind, placebo-controlled Phase 2 trial in 34 patients with hard-to-heal venous leg ulcers, topical LL-37 demonstrated statistically significant acceleration of healing rates compared to placebo, with a statistically significant dose-response curve and favorable safety profile.
KPV: KPV Preclinical Evidence
In preclinical murine colitis models (Dalmasso et al., Gastroenterology 2008), oral administration of KPV significantly reduced histological intestinal inflammation, decreased mucosal myeloperoxidase (MPO) activity, and promoted recovery of body weight in DSS colitis.
Cytotoxicity & Tolerability
Host defense peptides require careful dose calibration to avoid mammalian cell toxicity.
| Safety Consideration | LL-37 | KPV |
|---|---|---|
| Mammalian membrane cytotoxicity | High concentrations can cause hemolytic lysis of human red blood cells; requires narrow therapeutic window | Negligible cytotoxicity; high LD50 in animal studies |
| Pro-inflammatory potential | Excessive concentrations can trigger histamine release and mast cell degranulation | Strictly anti-inflammatory |
What LL-37 and KPV Have in Common
Where the two compounds overlap in biology, evidence or regulatory context.
Innate Host Defense
Both peptides are derived from human innate biological pathways that protect epithelial barriers.
Mucosal Healing Roles
Both molecules have been investigated for accelerating gut, skin, and mucosal wound closure.
Key Scientific & Clinical Differences
Meaningful distinctions in mechanism, strength of evidence, safety and regulatory status.
Primary Function
LL-37 physically kills bacterial pathogens and recruits immune cells; KPV silences intracellular inflammatory cytokine cascades.
Size & Conformation
LL-37 is a 37-amino-acid amphipathic alpha-helix; KPV is a tiny 3-amino-acid linear tripeptide.
Cytotoxicity Risk
LL-37 can lyse mammalian cells at supraphysiological doses; KPV exhibits virtually zero cytotoxic risk.
Scientific Comparison vs Clinical Recommendations
Inside Peptides compares scientific evidence, receptor pharmacology, and official regulatory documents to advance public and professional understanding. We do not determine which compound is appropriate for an individual patient, rank medications with arbitrary scores, or recommend initiating or switching treatments.
Decisions about any medicine require a licensed healthcare professional who can weigh personal medical history, contraindications, interactions and monitoring needs. Unapproved peptides have no established safe use, and products sold as “research chemicals” are not the preparations studied in clinical research.
Approved Uses vs Online Claims
A critical scientific distinction between verified, FDA-approved clinical uses and unverified claims circulating on social media and vendor platforms.
LL-37 and KPV can be injected to cure chronic Lyme disease and all autoimmune disorders
insufficientUnverified vendor marketing claims unsupported by clinical medical guidelines.
There are zero clinical trials demonstrating that systemic injections of LL-37 or KPV cure chronic Lyme disease or systemic autoimmunity. Systemic high-dose LL-37 carries risks of mast cell degranulation and vascular irritation.
Evidence Strength Across Clinical Domains
Inside Peptides evaluates scientific certainty at the claim level. Because clinical evidence varies significantly depending on the therapeutic endpoint evaluated, each domain is assessed independently.
Antimicrobial & Leg Ulcer Healing
LL-37 proven in Phase 2 clinical trials for venous leg ulcers; KPV has limited direct antibacterial action.
Mucosal Anti-Inflammatory Action
KPV validated in preclinical colitis models; LL-37 can be pro-inflammatory at high doses.
What Research Still Doesn’t Tell Us
Identifying open scientific questions, pending active-comparator trials, and areas where long-term clinical data remain incomplete.
Nano-Encapsulated LL-37 Delivery
Formulating lipid-nanoparticle-encapsulated LL-37 to eliminate host cytotoxicity while delivering targeted bactericidal action to antibiotic-resistant biofilms.
Related Compound Profiles
Individual profiles provide full molecular datasheets, CAS numbers, preclinical histories, and compound monographs.
Related Educational Resources
Scientific & Regulatory References
Every pharmacological mechanism, clinical trial result, and regulatory approval cited on this page is traceable to official FDA prescribing documentation, ClinicalTrials.gov registries, or peer-reviewed medical publications.
-
Peer-Reviewed RCT
Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled Phase 2 study
-
Peer-Reviewed Article
PepT1-mediated epithelial transport of the anti-inflammatory peptide Lys-Pro-Val (KPV) in intestinal inflammation